Secure WCF REST API using C# in ASP.Net

Question

i have this APIhttpserviceglobealicomservice1svcCountryit works fine the problem is any one can access the URL and see the data which i do not wantI want the it should be like URI access as facebook and google does so only those to whom i have given acccess then can see it and that access should be dynamically check like if i have given access to abccom url so it should check auto whethere the api call is coming from abccom or not else it should deny it

dharmendr · Accepted Answer

Hi naunaRefer below linkshttpssocialtechnetmicrosoftcomwikicontentsarticles32524acompleteguidetocreatesecurewcfrestapiwithsslandbasicauthenticationaspxhttpswwwcsharpcornercomUploadFile8ef97cwebserviceinAspNetsecuritybysoapauthenticationpahttpswwwcsharpcornercomUploadFilemanas1implementingusernamepasswordsecurityinwcfservicehttpswwwcsharpcornercomUploadFilevendettamitcreatesecurewcfrestapiwithcustombasicauthentication

nauna · Answer

thank you for the detailsfor eg if i have given to domain name abccom is there any way API can auto check whether the API call is coming from abccom or not i do not want user add id and pass it can be leaked out instead i want API should check whether the API call is coming abccom or not abccom is one url i will match the request api URL in my database but at the time of calling api methid api first send the URL to my database and check if that url exist or not if exist so call api else return error

Secure WCF REST API using C# in ASP.Net

How to get domain and subdomain name from an url in C#

Company

Explore

Follow us

Contact Us